SCOP 1.75: Domain d1y5nb1: 1y5n B:1-509

Lineage for d1y5nb1 (1y5n B:1-509)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families)

5. Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (13 proteins)
   members of this "family" may be more closely related to other ferredoxins than to each other

6. Protein Respiratory nitrate reductase 1 beta chain [102955] (1 species)

7. Species Escherichia coli [TaxId:562] [102956] (7 PDB entries)
   Uniprot P11349

8. Domain d1y5nb1: 1y5n B:1-509 [122649]
   Other proteins in same PDB: d1y5na1, d1y5na2, d1y5nc1
   automatically matched to d1q16b_
   complexed with 3ph, 6mo, aga, f3s, hem, md1, pci, sf4; mutant

Details for d1y5nb1

PDB Entry: 1y5n, 2.5 Å

PDB Description: the crystal structure of the narghi mutant nari-k86a in complex with pentachlorophenol

PDB Compounds: (B:) Respiratory nitrate reductase 1 beta chain

SCOP Domain Sequences for d1y5nb1:

Sequence; same for both SEQRES and ATOM records:

>d1y5nb1 d.58.1.5 (B:1-509) Respiratory nitrate reductase 1 beta chain {Escherichia coli [TaxId: 562]}
mkirsqvgmvlnldkcigchtcsvtcknvwtsregveyawfnnvetkpgqgfptdwenqe
kykggwirkingklqprmgnramllgkifanphlpgiddyyepfdfdyqnlhtapegsks
qpiarprslitgermakiekgpnweddlggefdklakdknfdniqkamysqfentfmmyl
prlcehclnpacvatcpsgaiykreedgivlidqdkcrgwrmcitgcpykkiyfnwksgk
sekcifcyprieagqptvcsetcvgrirylgvllydadaieraastenekdlyqrqldvf
ldpndpkvieqaikdgiplsvieaaqqspvykmamewklalplhpeyrtlpmvwyvppls
piqsaadagelgsngilpdveslripvqylanlltagdtkpvlralkrmlamrhykraet
vdgkvdtraleevglteaqaqemyrylaianyedrfvvpsshrelareafpekngcgftf
gdgchgsdtkfnlfnsrridaidvtskte

Timeline for d1y5nb1:

• d1y5nb1 first appeared in SCOP 1.73
  
• d1y5nb1 is called d1y5nb_ in SCOPe 2.01
  
• d1y5nb1 appears in the current release, SCOPe 2.08, called d1y5nb_