Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) |
Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins) members of this "family" may be more closely related to other ferredoxins than to each other in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
Protein Respiratory nitrate reductase 1 beta chain [102955] (2 species) |
Species Escherichia coli [TaxId:562] [102956] (8 PDB entries) Uniprot P11349 |
Domain d1y5nb_: 1y5n B: [122649] Other proteins in same PDB: d1y5na1, d1y5na2, d1y5nc_ automated match to d1q16b_ complexed with 3ph, 6mo, aga, f3s, hem, md1, pci, sf4; mutant |
PDB Entry: 1y5n (more details), 2.5 Å
SCOPe Domain Sequences for d1y5nb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y5nb_ d.58.1.5 (B:) Respiratory nitrate reductase 1 beta chain {Escherichia coli [TaxId: 562]} mkirsqvgmvlnldkcigchtcsvtcknvwtsregveyawfnnvetkpgqgfptdwenqe kykggwirkingklqprmgnramllgkifanphlpgiddyyepfdfdyqnlhtapegsks qpiarprslitgermakiekgpnweddlggefdklakdknfdniqkamysqfentfmmyl prlcehclnpacvatcpsgaiykreedgivlidqdkcrgwrmcitgcpykkiyfnwksgk sekcifcyprieagqptvcsetcvgrirylgvllydadaieraastenekdlyqrqldvf ldpndpkvieqaikdgiplsvieaaqqspvykmamewklalplhpeyrtlpmvwyvppls piqsaadagelgsngilpdveslripvqylanlltagdtkpvlralkrmlamrhykraet vdgkvdtraleevglteaqaqemyrylaianyedrfvvpsshrelareafpekngcgftf gdgchgsdtkfnlfnsrridaidvtskte
Timeline for d1y5nb_: