Lineage for d1y5ib1 (1y5i B:1-509)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 723374Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) (S)
  5. 723475Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (11 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 723557Protein Respiratory nitrate reductase 1 beta chain [102955] (1 species)
  7. 723558Species Escherichia coli [TaxId:562] [102956] (6 PDB entries)
  8. 723559Domain d1y5ib1: 1y5i B:1-509 [122641]
    Other proteins in same PDB: d1y5ia1, d1y5ia2
    automatically matched to d1q16b_
    complexed with 3ph, 6mo, aga, f3s, hem, md1, sf4; mutant

Details for d1y5ib1

PDB Entry: 1y5i (more details), 1.9 Å

PDB Description: the crystal structure of the narghi mutant nari-k86a
PDB Compounds: (B:) Respiratory nitrate reductase 1 beta chain

SCOP Domain Sequences for d1y5ib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y5ib1 d.58.1.5 (B:1-509) Respiratory nitrate reductase 1 beta chain {Escherichia coli [TaxId: 562]}
mkirsqvgmvlnldkcigchtcsvtcknvwtsregveyawfnnvetkpgqgfptdwenqe
kykggwirkingklqprmgnramllgkifanphlpgiddyyepfdfdyqnlhtapegsks
qpiarprslitgermakiekgpnweddlggefdklakdknfdniqkamysqfentfmmyl
prlcehclnpacvatcpsgaiykreedgivlidqdkcrgwrmcitgcpykkiyfnwksgk
sekcifcyprieagqptvcsetcvgrirylgvllydadaieraastenekdlyqrqldvf
ldpndpkvieqaikdgiplsvieaaqqspvykmamewklalplhpeyrtlpmvwyvppls
piqsaadagelgsngilpdveslripvqylanlltagdtkpvlralkrmlamrhykraet
vdgkvdtraleevglteaqaqemyrylaianyedrfvvpsshrelareafpekngcgftf
gdgchgsdtkfnlfnsrridaidvtskte

SCOP Domain Coordinates for d1y5ib1:

Click to download the PDB-style file with coordinates for d1y5ib1.
(The format of our PDB-style files is described here.)

Timeline for d1y5ib1: