Lineage for d1y5ia2 (1y5i A:1-1074)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 709298Fold c.81: Formate dehydrogenase/DMSO reductase, domains 1-3 [53705] (1 superfamily)
    contains of two similar intertwined domains related by pseudo dyad; duplication
    core: 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451
  4. 709299Superfamily c.81.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53706] (1 family) (S)
    molybdopterine enzyme
  5. 709300Family c.81.1.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53707] (10 proteins)
    domain 1 (residues 1-55) binds Fe4S4 cluster in FDH but not DMSO reductase
  6. 709355Protein Respiratory nitrate reductase 1 alpha chain [102673] (1 species)
  7. 709356Species Escherichia coli [TaxId:562] [102674] (7 PDB entries)
  8. 709357Domain d1y5ia2: 1y5i A:1-1074 [122640]
    Other proteins in same PDB: d1y5ia1, d1y5ib1
    automatically matched to d1q16a2
    complexed with 3ph, 6mo, aga, f3s, hem, md1, sf4; mutant

Details for d1y5ia2

PDB Entry: 1y5i (more details), 1.9 Å

PDB Description: the crystal structure of the narghi mutant nari-k86a
PDB Compounds: (A:) Respiratory nitrate reductase 1 alpha chain

SCOP Domain Sequences for d1y5ia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y5ia2 c.81.1.1 (A:1-1074) Respiratory nitrate reductase 1 alpha chain {Escherichia coli [TaxId: 562]}
skfldrfryfkqkgetfadghgqllntnrdwedgyrqrwqhdkivrsthgvnctgscswk
iyvknglvtwetqqtdyprtrpdlpnheprgcprgasyswylysanrlkypmmrkrlmkm
wreakalhsdpveawasiiedadkaksfkqargrggfvrsswqevneliaasnvytikny
gpdrvagfspipamsmvsyasgarylsliggtclsfydwycdlppaspqtwgeqtdvpes
adwynssyiiawgsnvpqtrtpdahfftevrykgtktvavtpdyaeiaklcdlwlapkqg
tdaamalamghvmlrefhldnpsqyftdyvrrytdmpmlvmleerdgyyaagrmlraadl
vdalgqennpewktvafntngemvapngsigfrwgekgkwnleqrdgktgeetelqlsll
gsqdeiaevgfpyfggdgtehfnkvelenvllhklpvkrlqladgstalvttvydltlan
yglerglndvncatsyddvkaytpawaeqitgvsrsqiiriarefadnadkthgrsmiiv
gaglnhwyhldmnyrglinmlifcgcvgqsgggwahyvgqeklrpqtgwqplafaldwqr
parhmnstsyfynhssqwryetvtaeellspmadksrytghlidfnvraermgwlpsapq
lgtnpltiageaekagmnpvdytvkslkegsirfaaeqpengknhprnlfiwrsnllgss
gkghefmlkyllgtehgiqgkdlgqqggvkpeevdwqdnglegkldlvvtldfrlsstcl
ysdiilptatwyekddmntsdmhpfihplsaavdpaweaksdweiykaiakkfsevcvgh
lgketdivtlpiqhdsaaelaqpldvkdwkkgecdlipgktaphimvverdypatyerft
sigplmekignggkgiawntqsemdllrklnytkaegpakgqpmlntaidaaemiltlap
etngqvavkawaalseftgrdhthlalnkedekirfrdiqaqprkiissptwsgledehv
synagytnvhelipwrtlsgrqqlyqdhqwmrdfgesllvyrppidtrsvkevi

SCOP Domain Coordinates for d1y5ia2:

Click to download the PDB-style file with coordinates for d1y5ia2.
(The format of our PDB-style files is described here.)

Timeline for d1y5ia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1y5ia1
View in 3D
Domains from other chains:
(mouse over for more information)
d1y5ib1