Class b: All beta proteins [48724] (176 folds) |
Fold b.52: Double psi beta-barrel [50684] (2 superfamilies) barrel, closed; n=6, S=10; complex topology with crossover (psi) loops |
Superfamily b.52.2: ADC-like [50692] (4 families) |
Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins) molybdopterine enzyme |
Protein Respiratory nitrate reductase 1 alpha chain [101828] (1 species) |
Species Escherichia coli [TaxId:562] [101829] (7 PDB entries) Uniprot P09152 |
Domain d1y5ia1: 1y5i A:1075-1244 [122639] Other proteins in same PDB: d1y5ia2, d1y5ib_, d1y5ic1 automated match to d1siwa1 complexed with 3ph, 6mo, aga, f3s, hem, md1, sf4; mutant |
PDB Entry: 1y5i (more details), 1.9 Å
SCOPe Domain Sequences for d1y5ia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y5ia1 b.52.2.2 (A:1075-1244) Respiratory nitrate reductase 1 alpha chain {Escherichia coli [TaxId: 562]} gqksngnqekalnfltphqkwgihstysdnllmltlgrggpvvwlseadakdlgiadndw ievfnsngaltaravvsqrvpagmtmmyhaqerivnlpgseitqqrggihnsvtritpkp thmiggyahlaygfnyygtvgsnrdefvvvrkmknidwldgegndqvqes
Timeline for d1y5ia1: