SCOPe 2.08: Domain d1y5ia1: 1y5i A:1075-1244

Lineage for d1y5ia1 (1y5i A:1075-1244)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.2: ADC-like [50692] (4 families)

5. Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins)
   molybdopterine enzyme

6. Protein Respiratory nitrate reductase 1 alpha chain [101828] (1 species)

7. Species Escherichia coli [TaxId:562] [101829] (7 PDB entries)
   Uniprot P09152

8. Domain d1y5ia1: 1y5i A:1075-1244 [122639]
   Other proteins in same PDB: d1y5ia2, d1y5ib_, d1y5ic1
   automated match to d1siwa1
   complexed with 3ph, 6mo, aga, f3s, hem, md1, sf4; mutant

Details for d1y5ia1

PDB Entry: 1y5i, 1.9 Å

PDB Description: the crystal structure of the narghi mutant nari-k86a

PDB Compounds: (A:) Respiratory nitrate reductase 1 alpha chain

SCOPe Domain Sequences for d1y5ia1:

Sequence; same for both SEQRES and ATOM records:

>d1y5ia1 b.52.2.2 (A:1075-1244) Respiratory nitrate reductase 1 alpha chain {Escherichia coli [TaxId: 562]}
gqksngnqekalnfltphqkwgihstysdnllmltlgrggpvvwlseadakdlgiadndw
ievfnsngaltaravvsqrvpagmtmmyhaqerivnlpgseitqqrggihnsvtritpkp
thmiggyahlaygfnyygtvgsnrdefvvvrkmknidwldgegndqvqes

Timeline for d1y5ia1:

• d1y5ia1 first appeared in SCOP 1.73
  
• d1y5ia1 appears in SCOPe 2.07