Lineage for d1y4zc_ (1y4z C:)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1059237Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 1059364Superfamily f.21.3: Respiratory nitrate reductase 1 gamma chain [103501] (1 family) (S)
    possible link between the two other superfamilies: this subunit corresponds to the gamma subunit of a functionally related Formate dehydrogenase N complex but is structurally closer to the Fumarate reductase subunit FrdC
  5. 1059365Family f.21.3.1: Respiratory nitrate reductase 1 gamma chain [103502] (2 proteins)
  6. 1059366Protein Respiratory nitrate reductase 1 gamma chain [103503] (1 species)
  7. 1059367Species Escherichia coli [TaxId:562] [103504] (6 PDB entries)
    Uniprot P11350
  8. 1059370Domain d1y4zc_: 1y4z C: [122631]
    Other proteins in same PDB: d1y4za1, d1y4za2, d1y4zb1
    automated match to d1q16c_
    complexed with 6mo, aga, f3s, hem, md1, pci, sf4

Details for d1y4zc_

PDB Entry: 1y4z (more details), 2 Å

PDB Description: the crystal structure of nitrate reductase a, narghi, in complex with the q-site inhibitor pentachlorophenol
PDB Compounds: (C:) Respiratory nitrate reductase 1 gamma chain

SCOPe Domain Sequences for d1y4zc_:

Sequence, based on SEQRES records: (download)

>d1y4zc_ f.21.3.1 (C:) Respiratory nitrate reductase 1 gamma chain {Escherichia coli [TaxId: 562]}
mqflnmfffdiypyiagavfligswlrydygqytwraassqmldrkgmnlasnlfhigil
gifvghffgmltphwmyeawlpievkqkmamfaggasgvlcliggvlllkrrlfsprvra
tttgadililsllviqcalglltipfsaqhmdgsemmklvgwaqsvvtfhggasqhldgv
afifrlhlvlgmtlfllfpfsrlihiwsvpveyltrkyqlvrarh

Sequence, based on observed residues (ATOM records): (download)

>d1y4zc_ f.21.3.1 (C:) Respiratory nitrate reductase 1 gamma chain {Escherichia coli [TaxId: 562]}
mqflnmfffdiypyiagavfligswlrydygqytwraassqmldrkgmnlasnlfhigil
gifvghffgmltlpievkqkmamfaggasgvlcliggvlllkrrlfsprvratttgadil
ilsllviqcalglltipfsaqhmdgsemmklvgwaqsvvtfhggasqhldgvafifrlhl
vlgmtlfllfpfsrlihiwsvpveyltrkyqlvrarh

SCOPe Domain Coordinates for d1y4zc_:

Click to download the PDB-style file with coordinates for d1y4zc_.
(The format of our PDB-style files is described here.)

Timeline for d1y4zc_: