Class a: All alpha proteins [46456] (284 folds) |
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) |
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins) |
Protein Snake phospholipase A2 [48624] (35 species) |
Species Terciopelo (Bothrops asper), myotoxin I [TaxId:8722] [48644] (2 PDB entries) |
Domain d1y4la1: 1y4l A:1-133 [122624] automatically matched to d1clpa_ complexed with ipa, p33, svr |
PDB Entry: 1y4l (more details), 1.7 Å
SCOP Domain Sequences for d1y4la1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y4la1 a.133.1.2 (A:1-133) Snake phospholipase A2 {Terciopelo (Bothrops asper), myotoxin I [TaxId: 8722]} slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcnpk kdrysyswkdktivcgennsclkelcecdkavaiclrenlntynkkyryylkplckkada c
Timeline for d1y4la1: