SCOPe 2.08: Domain d1y38b_: 1y38 B:

Lineage for d1y38b_ (1y38 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein automated matches [190139] (27 species)
   not a true protein

7. Species Daboia russellii [TaxId:97228] [186865] (27 PDB entries)

8. Domain d1y38b_: 1y38 B: [122581]
   automated match to d1tgma_
   complexed with g3p, na, pge, so4

Details for d1y38b_

PDB Entry: 1y38, 2.44 Å

PDB Description: Crystal structure of the complex formed between phospholipase A2 dimer and glycerophosphate at 2.4 A resolution

PDB Compounds: (B:) Phospholipase A2 VRV-PL-VIIIa

SCOPe Domain Sequences for d1y38b_:

Sequence; same for both SEQRES and ATOM records:

>d1y38b_ a.133.1.2 (B:) automated matches {Daboia russellii [TaxId: 97228]}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

Timeline for d1y38b_:

• d1y38b_ first appeared in SCOP 1.73, called d1y38b1
  
• d1y38b_ appears in SCOPe 2.07