SCOPe 2.01: Domain d1y38a_: 1y38 A:

Lineage for d1y38a_ (1y38 A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)

6. Protein automated matches [190139] (19 species)
   not a true protein

7. Species Daboia russellii [TaxId:97228] [186865] (26 PDB entries)

8. Domain d1y38a_: 1y38 A: [122580]
   automated match to d1tgma_
   complexed with g3p, na, pge, so4

Details for d1y38a_

PDB Entry: 1y38, 2.44 Å

PDB Description: Crystal structure of the complex formed between phospholipase A2 dimer and glycerophosphate at 2.4 A resolution

PDB Compounds: (A:) Phospholipase A2 VRV-PL-VIIIa

SCOPe Domain Sequences for d1y38a_:

Sequence; same for both SEQRES and ATOM records:

>d1y38a_ a.133.1.2 (A:) automated matches {Daboia russellii [TaxId: 97228]}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

Timeline for d1y38a_:

• d1y38a_ first appeared in SCOP 1.73, called d1y38a1
  
• d1y38a_ was called d1y38a1 in SCOP 1.75
  
• d1y38a_ appears in SCOPe 2.02
  
• d1y38a_ appears in the current release, SCOPe 2.08