SCOP 1.73: Domain d1y2hb1: 1y2h B:163-485

Lineage for d1y2hb1 (1y2h B:163-485)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (5 families)

5. Family a.211.1.2: PDEase [48548] (6 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89152] (20 PDB entries)

8. Domain d1y2hb1: 1y2h B:163-485 [122568]
   automatically matched to d1mkda_
   complexed with 6de, mg, zn

Details for d1y2hb1

PDB Entry: 1y2h, 2.4 Å

PDB Description: Catalytic Domain Of Human Phosphodiesterase 4B In Complex With 1-(2-chloro-phenyl)-3,5-dimethyl-1H-pyrazole-4-carboxylic acid ethyl ester

PDB Compounds: (B:) cAMP-specific 3',5'-cyclic phosphodiesterase 4B

SCOP Domain Sequences for d1y2hb1:

Sequence; same for both SEQRES and ATOM records:

>d1y2hb1 a.211.1.2 (B:163-485) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
edhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfrissdtfitymmt
ledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaaihdvdhpgvs
nqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrqtlrkmvidmv
latdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcadlsnptkslel
yrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyivhplwetwadlv
qpdaqdildtlednrnwyqsmip

Timeline for d1y2hb1:

• d1y2hb1 is new in SCOP 1.73
  
• d1y2hb1 appears in SCOP 1.75
  
• d1y2hb1 appears in the current release, SCOPe 2.08, called d1y2hb_