SCOPe 2.07: Domain d1y1pa1: 1y1p A:2-343

Lineage for d1y1pa1 (1y1p A:2-343)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

6. Protein Aldehyde reductase II [117413] (1 species)

7. Species Sporobolomyces salmonicolor [TaxId:5005] [117414] (3 PDB entries)
   Uniprot Q9UUN9

8. Domain d1y1pa1: 1y1p A:2-343 [122550]
   complexed with act, nmn, so4

Details for d1y1pa1

PDB Entry: 1y1p, 1.6 Å

PDB Description: X-ray structure of aldehyde reductase with NADPH

PDB Compounds: (A:) Aldehyde reductase II

SCOPe Domain Sequences for d1y1pa1:

Sequence; same for both SEQRES and ATOM records:

>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]}
akidnavlpegslvlvtgangfvashvveqllehgykvrgtarsasklanlqkrwdakyp
grfetavvedmlkqgaydevikgaagvahiasvvsfsnkydevvtpaiggtlnalraaaa
tpsvkrfvltsstvsalipkpnvegiyldekswnlesidkaktlpesdpqkslwvyaask
teaelaawkfmdenkphftlnavlpnytigtifdpetqsgstsgwmmslfngevspalal
mppqyyvsavdigllhlgclvlpqierrrvygtagtfdwntvlatfrklypsktfpadfp
dqgqdlskfdtapsleilkslgrpgwrsieesikdlvgseta

Timeline for d1y1pa1:

• d1y1pa1 first appeared in SCOP 1.73
  
• d1y1pa1 appears in SCOPe 2.06
  
• d1y1pa1 appears in the current release, SCOPe 2.08