Lineage for d1y1hx_ (1y1h X:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2234637Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2234638Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2235373Family d.169.1.7: Sulfatase-modifying factor-like [143959] (3 proteins)
    Pfam PF03781 (DUF323); fold decorated with many additional structures; C-alpha-formyglycine-generating enzyme
  6. 2235383Protein automated matches [190427] (1 species)
    not a true protein
  7. 2235384Species Human (Homo sapiens) [TaxId:9606] [187317] (11 PDB entries)
  8. 2235391Domain d1y1hx_: 1y1h X: [122544]
    automated match to d2afyx1
    complexed with peo, sr

Details for d1y1hx_

PDB Entry: 1y1h (more details), 1.67 Å

PDB Description: human formylglycine generating enzyme, oxidised cys refined as hydroperoxide
PDB Compounds: (X:) C-alpha-formyglycine-generating enzyme

SCOPe Domain Sequences for d1y1hx_:

Sequence, based on SEQRES records: (download)

>d1y1hx_ d.169.1.7 (X:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lahskmvpipagvftmgtddpqikqdgeaparrvtidafymdayevsntefekfvnstgy
lteaekfgdsfvfegmlseqvktniqqavaaapwwlpvkganwrhpegpdstilhrpdhp
vlhvswndavayctwagkrlpteaeweyscrgglhnrlfpwgnklqpkgqhyaniwqgef
pvtntgedgfqgtapvdafppngyglynivgnawewtsdwwtvhhsveetlnpkgppsgk
drvkkggsymchrsycyryrcaarsqntpdssasnlgfrcaadrlpt

Sequence, based on observed residues (ATOM records): (download)

>d1y1hx_ d.169.1.7 (X:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lahskmvpipagvftmgtddpqikqdgeaparrvtidafymdayevsntefekfvnstgy
lteaekfgdsfvfegmlaaapwwlpvkganwrhpegpdstilhrpdhpvlhvswndavay
ctwagkrlpteaeweyscrgglhnrlfpwgnklqpkgqhyaniwqgefpvtntgedgfqg
tapvdafppngyglynivgnawewtsdwwtvhhsveetlnpkgppsgkdrvkkggsymch
rsycyryrcaarsqntpdssasnlgfrcaadrlpt

SCOPe Domain Coordinates for d1y1hx_:

Click to download the PDB-style file with coordinates for d1y1hx_.
(The format of our PDB-style files is described here.)

Timeline for d1y1hx_: