SCOP 1.73: Domain d1y18c2: 1y18 C:108-212

Lineage for d1y18c2 (1y18 C:108-212)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (125 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d1y18c2: 1y18 C:108-212 [122526]
   Other proteins in same PDB: d1y18a1, d1y18b1, d1y18b2, d1y18c1, d1y18d1, d1y18d2, d1y18e1, d1y18f1, d1y18f2, d1y18h1, d1y18h2, d1y18l1
   automatically matched to d1g9ml2
   complexed with cl, han; mutant

Details for d1y18c2

PDB Entry: 1y18, 2.8 Å

PDB Description: fab fragment of catalytic elimination antibody 34e4 e(h50)d mutant in complex with hapten

PDB Compounds: (C:) Catalytic antibody 34E4 light chain

SCOP Domain Sequences for d1y18c2:

Sequence; same for both SEQRES and ATOM records:

>d1y18c2 b.1.1.2 (C:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d1y18c2:

• d1y18c2 is new in SCOP 1.73
  
• d1y18c2 appears in SCOP 1.75
  
• d1y18c2 appears in the current release, SCOPe 2.08