Lineage for d1y18a2 (1y18 A:108-212)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2748802Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 2748803Species Human (Homo sapiens) [TaxId:9606] [88569] (147 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody
  8. 2748986Domain d1y18a2: 1y18 A:108-212 [122522]
    Other proteins in same PDB: d1y18a1, d1y18b1, d1y18b2, d1y18c1, d1y18d1, d1y18d2, d1y18e1, d1y18f1, d1y18f2, d1y18h1, d1y18h2, d1y18l1
    automatically matched to d1g9ml2
    complexed with cl, han; mutant

Details for d1y18a2

PDB Entry: 1y18 (more details), 2.8 Å

PDB Description: fab fragment of catalytic elimination antibody 34e4 e(h50)d mutant in complex with hapten
PDB Compounds: (A:) Catalytic antibody 34E4 light chain

SCOPe Domain Sequences for d1y18a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y18a2 b.1.1.2 (A:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d1y18a2:

Click to download the PDB-style file with coordinates for d1y18a2.
(The format of our PDB-style files is described here.)

Timeline for d1y18a2: