Lineage for d1y0sb1 (1y0s B:209-475)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 647844Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 647845Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 647846Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (32 proteins)
  6. 648142Protein Peroxisome proliferator-activated receptor delta, PPAR-DELTA [48526] (1 species)
  7. 648143Species Human (Homo sapiens) [TaxId:9606] [48527] (8 PDB entries)
  8. 648151Domain d1y0sb1: 1y0s B:209-475 [122513]
    automatically matched to d1gwxa_
    complexed with 331, b7g, iod

Details for d1y0sb1

PDB Entry: 1y0s (more details), 2.65 Å

PDB Description: Crystal structure of PPAR delta complexed with GW2331
PDB Compounds: (B:) Peroxisome proliferator activated receptor delta

SCOP Domain Sequences for d1y0sb1:

Sequence, based on SEQRES records: (download)

>d1y0sb1 a.123.1.1 (B:209-475) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]}
adlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwkqlv
nglppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifa
mlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfi
aaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvte
haqmmqrikktetetslhpllqeiykd

Sequence, based on observed residues (ATOM records): (download)

>d1y0sb1 a.123.1.1 (B:209-475) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]}
adlkafskhiynaylknfnmtkkkarsiltgapfvihdietlwqaekglvwglppykeis
vhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifamlasivnkdg
llvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaaiilcgdrp
glmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvtehaqmmqrikk
tetetslhpllqeiykd

SCOP Domain Coordinates for d1y0sb1:

Click to download the PDB-style file with coordinates for d1y0sb1.
(The format of our PDB-style files is described here.)

Timeline for d1y0sb1: