SCOP 1.73: Domain d1y0ll1: 1y0l L:1-107

Lineage for d1y0ll1 (1y0l L:1-107)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 3.2 [TaxId:9606] [88523] (29 PDB entries)

8. Domain d1y0ll1: 1y0l L:1-107 [122500]
   Other proteins in same PDB: d1y0la2, d1y0lb1, d1y0lb2, d1y0lc2, d1y0ld1, d1y0ld2, d1y0le2, d1y0lf1, d1y0lf2, d1y0lh1, d1y0lh2, d1y0ll2
   automatically matched to d1g9ml1
   complexed with cl, han

Details for d1y0ll1

PDB Entry: 1y0l, 2.5 Å

PDB Description: Catalytic elimination antibody 34E4 in complex with hapten

PDB Compounds: (L:) Catalytic Antibody Fab 34E4 Light chain

SCOP Domain Sequences for d1y0ll1:

Sequence; same for both SEQRES and ATOM records:

>d1y0ll1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]}
elvvtqesalttspgetvtltcrsssgavttsnyatwvqekpdhlftgliggtnkrapgv
parfsgsligdraaltitgaqtedeaiyfcalwnsnhlvfgggtkleik

Timeline for d1y0ll1:

• d1y0ll1 is new in SCOP 1.73
  
• d1y0ll1 appears in SCOP 1.75
  
• d1y0ll1 appears in the current release, SCOPe 2.08