Lineage for d1y0le2 (1y0l E:108-212)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1293251Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 1293252Species Human (Homo sapiens) [TaxId:9606] [88569] (147 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody
  8. 1293350Domain d1y0le2: 1y0l E:108-212 [122495]
    Other proteins in same PDB: d1y0la1, d1y0lb1, d1y0lb2, d1y0lc1, d1y0ld1, d1y0ld2, d1y0le1, d1y0lf1, d1y0lf2, d1y0lh1, d1y0lh2, d1y0ll1
    automatically matched to d1g9ml2
    complexed with cl, han

Details for d1y0le2

PDB Entry: 1y0l (more details), 2.5 Å

PDB Description: Catalytic elimination antibody 34E4 in complex with hapten
PDB Compounds: (E:) Catalytic Antibody Fab 34E4 Light chain

SCOPe Domain Sequences for d1y0le2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y0le2 b.1.1.2 (E:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d1y0le2:

Click to download the PDB-style file with coordinates for d1y0le2.
(The format of our PDB-style files is described here.)

Timeline for d1y0le2: