Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species) |
Species Human (Homo sapiens) [TaxId:9606] [88575] (179 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody |
Domain d1y0ld2: 1y0l D:114-233 [122493] Other proteins in same PDB: d1y0la1, d1y0la2, d1y0lb1, d1y0lc1, d1y0lc2, d1y0ld1, d1y0le1, d1y0le2, d1y0lf1, d1y0lh1, d1y0ll1, d1y0ll2 automatically matched to d1aqkh2 complexed with cl, han |
PDB Entry: 1y0l (more details), 2.5 Å
SCOPe Domain Sequences for d1y0ld2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y0ld2 b.1.1.2 (D:114-233) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]} astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
Timeline for d1y0ld2: