Lineage for d1y0ld2 (1y0l D:114-233)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655115Species Human (Homo sapiens) [TaxId:9606] [88575] (150 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 655219Domain d1y0ld2: 1y0l D:114-233 [122493]
    Other proteins in same PDB: d1y0la1, d1y0la2, d1y0lb1, d1y0lc1, d1y0lc2, d1y0ld1, d1y0le1, d1y0le2, d1y0lf1, d1y0lh1, d1y0ll1, d1y0ll2
    automatically matched to d1aqkh2
    complexed with cl, han

Details for d1y0ld2

PDB Entry: 1y0l (more details), 2.5 Å

PDB Description: Catalytic elimination antibody 34E4 in complex with hapten
PDB Compounds: (D:) Catalytic Antibody Fab 34E4 Heavy chain

SCOP Domain Sequences for d1y0ld2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y0ld2 b.1.1.2 (D:114-233) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

SCOP Domain Coordinates for d1y0ld2:

Click to download the PDB-style file with coordinates for d1y0ld2.
(The format of our PDB-style files is described here.)

Timeline for d1y0ld2: