Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species) Class I MHC-related |
Species Human (Homo sapiens), CD1a [TaxId:9606] [102838] (8 PDB entries) |
Domain d1xz0c2: 1xz0 C:8-183 [122465] Other proteins in same PDB: d1xz0a1, d1xz0b_, d1xz0c1, d1xz0d_ automatically matched to d1onqa2 complexed with jh0 |
PDB Entry: 1xz0 (more details), 2.8 Å
SCOPe Domain Sequences for d1xz0c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xz0c2 d.19.1.1 (C:8-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1a [TaxId: 9606]} lsfhviwiasfynhswkqnlvsgwlsdlqthtwdsnsstivflwpwsrgnfsneewkele tlfrirtirsfegirryahelqfeypfeiqvtggcelhsgkvsgsflqlayqgsdfvsfq nnswlpypvagnmakhfckvlnqnqhendithnllsdtcprfilglldagkahlqr
Timeline for d1xz0c2:
View in 3D Domains from other chains: (mouse over for more information) d1xz0a1, d1xz0a2, d1xz0b_, d1xz0d_ |