Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein CD1, alpha-3 domain [88615] (4 species) |
Species Human (Homo sapiens), CD1a [TaxId:9606] [101513] (3 PDB entries) |
Domain d1xz0c1: 1xz0 C:184-277 [122464] Other proteins in same PDB: d1xz0a2, d1xz0b_, d1xz0c2, d1xz0d_ automatically matched to d1onqa1 complexed with jh0 |
PDB Entry: 1xz0 (more details), 2.8 Å
SCOPe Domain Sequences for d1xz0c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xz0c1 b.1.1.2 (C:184-277) CD1, alpha-3 domain {Human (Homo sapiens), CD1a [TaxId: 9606]} qvkpeawlshgpspgpghlqlvchvsgfypkpvwvmwmrgeqeqqgtqrgdilpsadgtw ylratlevaageaadlscrvkhsslegqdivlyw
Timeline for d1xz0c1:
View in 3D Domains from other chains: (mouse over for more information) d1xz0a1, d1xz0a2, d1xz0b_, d1xz0d_ |