Lineage for d1xz0c1 (1xz0 C:184-277)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 932610Protein CD1, alpha-3 domain [88615] (4 species)
  7. 932611Species Human (Homo sapiens), CD1a [TaxId:9606] [101513] (3 PDB entries)
  8. 932616Domain d1xz0c1: 1xz0 C:184-277 [122464]
    Other proteins in same PDB: d1xz0a2, d1xz0b_, d1xz0c2, d1xz0d_
    automatically matched to d1onqa1
    complexed with jh0

Details for d1xz0c1

PDB Entry: 1xz0 (more details), 2.8 Å

PDB Description: crystal structure of cd1a in complex with a synthetic mycobactin lipopeptide
PDB Compounds: (C:) T-cell surface glycoprotein CD1a

SCOPe Domain Sequences for d1xz0c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xz0c1 b.1.1.2 (C:184-277) CD1, alpha-3 domain {Human (Homo sapiens), CD1a [TaxId: 9606]}
qvkpeawlshgpspgpghlqlvchvsgfypkpvwvmwmrgeqeqqgtqrgdilpsadgtw
ylratlevaageaadlscrvkhsslegqdivlyw

SCOPe Domain Coordinates for d1xz0c1:

Click to download the PDB-style file with coordinates for d1xz0c1.
(The format of our PDB-style files is described here.)

Timeline for d1xz0c1: