![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein beta2-microglobulin [88600] (5 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88602] (328 PDB entries) Uniprot P61769 21-119 ! Uniprot P01884 |
![]() | Domain d1xz0b_: 1xz0 B: [122463] Other proteins in same PDB: d1xz0a1, d1xz0a2, d1xz0c1, d1xz0c2 automated match to d1a1mb_ complexed with jh0 |
PDB Entry: 1xz0 (more details), 2.8 Å
SCOPe Domain Sequences for d1xz0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xz0b_ b.1.1.2 (B:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw sfyllyyteftptekdeyacrvnhvtlsqpkivkwdrd
Timeline for d1xz0b_: