Lineage for d1xz0a2 (1xz0 A:7-183)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1405985Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1405986Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1405987Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1405988Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
    Class I MHC-related
  7. 1405993Species Human (Homo sapiens), CD1a [TaxId:9606] [102838] (8 PDB entries)
  8. 1406004Domain d1xz0a2: 1xz0 A:7-183 [122462]
    Other proteins in same PDB: d1xz0a1, d1xz0b_, d1xz0c1, d1xz0d_
    automatically matched to d1onqa2
    complexed with jh0

Details for d1xz0a2

PDB Entry: 1xz0 (more details), 2.8 Å

PDB Description: crystal structure of cd1a in complex with a synthetic mycobactin lipopeptide
PDB Compounds: (A:) T-cell surface glycoprotein CD1a

SCOPe Domain Sequences for d1xz0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xz0a2 d.19.1.1 (A:7-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1a [TaxId: 9606]}
plsfhviwiasfynhswkqnlvsgwlsdlqthtwdsnsstivflwpwsrgnfsneewkel
etlfrirtirsfegirryahelqfeypfeiqvtggcelhsgkvsgsflqlayqgsdfvsf
qnnswlpypvagnmakhfckvlnqnqhendithnllsdtcprfilglldagkahlqr

SCOPe Domain Coordinates for d1xz0a2:

Click to download the PDB-style file with coordinates for d1xz0a2.
(The format of our PDB-style files is described here.)

Timeline for d1xz0a2: