Class a: All alpha proteins [46456] (284 folds) |
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) |
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins) |
Protein Snake phospholipase A2 [48624] (35 species) |
Species Indian cobra (Naja naja) [TaxId:35670] [48626] (4 PDB entries) |
Domain d1xxwb1: 1xxw B:1-119 [122432] automatically matched to d1a3d__ complexed with acy, zn |
PDB Entry: 1xxw (more details), 2.7 Å
SCOP Domain Sequences for d1xxwb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xxwb1 a.133.1.2 (B:1-119) Snake phospholipase A2 {Indian cobra (Naja naja) [TaxId: 35670]} nrwqfknmisctvpsrswwdfadygcycgrggsgtpvddldrccqvhdncyneaekisgc nprfrtysyectagtltctgrnnacaasvcdcdrlaaicfagapyndnnynidlqarc
Timeline for d1xxwb1: