SCOP 1.75: Domain d1xxwb1: 1xxw B:1-119

Lineage for d1xxwb1 (1xxw B:1-119)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)

6. Protein Snake phospholipase A2 [48624] (35 species)

7. Species Indian cobra (Naja naja) [TaxId:35670] [48626] (4 PDB entries)

8. Domain d1xxwb1: 1xxw B:1-119 [122432]
   automatically matched to d1a3d__
   complexed with acy, zn

Details for d1xxwb1

PDB Entry: 1xxw, 2.7 Å

PDB Description: Structure of zinc induced heterodimer of two calcium free isoforms of phospholipase A2 from Naja naja sagittifera at 2.7A resolution

PDB Compounds: (B:) Phospholipase A2 isoform 2

SCOP Domain Sequences for d1xxwb1:

Sequence; same for both SEQRES and ATOM records:

>d1xxwb1 a.133.1.2 (B:1-119) Snake phospholipase A2 {Indian cobra (Naja naja) [TaxId: 35670]}
nrwqfknmisctvpsrswwdfadygcycgrggsgtpvddldrccqvhdncyneaekisgc
nprfrtysyectagtltctgrnnacaasvcdcdrlaaicfagapyndnnynidlqarc

Timeline for d1xxwb1:

• d1xxwb1 first appeared in SCOP 1.73
  
• d1xxwb1 is called d1xxwb_ in SCOPe 2.01
  
• d1xxwb1 appears in the current release, SCOPe 2.08, called d1xxwb_