Lineage for d1xxwa1 (1xxw A:1-120)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 777954Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 777955Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 777960Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 778048Protein Snake phospholipase A2 [48624] (35 species)
  7. 778084Species Indian cobra (Naja naja) [TaxId:35670] [48626] (4 PDB entries)
  8. 778092Domain d1xxwa1: 1xxw A:1-120 [122431]
    automatically matched to d1a3d__
    complexed with acy, zn

Details for d1xxwa1

PDB Entry: 1xxw (more details), 2.7 Å

PDB Description: Structure of zinc induced heterodimer of two calcium free isoforms of phospholipase A2 from Naja naja sagittifera at 2.7A resolution
PDB Compounds: (A:) Phospholipase A2 isoform 1

SCOP Domain Sequences for d1xxwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xxwa1 a.133.1.2 (A:1-120) Snake phospholipase A2 {Indian cobra (Naja naja) [TaxId: 35670]}
ntyqfknmiqctvpkrswwdfadygcycgrggsgtpiddldrccqvhdncynsareqggc
rpkqktysyeckagtlscsgsnnscaatvcdcdrlaaicfagapyndnnynidlkarcq

SCOP Domain Coordinates for d1xxwa1:

Click to download the PDB-style file with coordinates for d1xxwa1.
(The format of our PDB-style files is described here.)

Timeline for d1xxwa1: