![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
![]() | Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (5 families) ![]() share with the family I the common active site structure with a circularly permuted topology |
![]() | Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (6 proteins) has an extension to the beta-sheet of 3 antiparallel strands before strand 4 |
![]() | Protein Protein-tyrosine phosphatase YopH, catalytic domain [100952] (1 species) |
![]() | Species Yersinia enterocolitica [TaxId:630] [52812] (10 PDB entries) |
![]() | Domain d1xxvb1: 1xxv B:187-468 [122430] automatically matched to d1pa9a_ complexed with fty; mutant |
PDB Entry: 1xxv (more details), 2.5 Å
SCOP Domain Sequences for d1xxvb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xxvb1 c.45.1.2 (B:187-468) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} spygpearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradlna nyiqvgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqsg tygsitveskmtqqvglgdgimadmytltireagqktisvpvvhvgnwpdqtavssevtk alaslvdqtaetkrnmyeskgssavaddsklrpvihcragvgrtaqligamcmndsrnsq lsvedmvsqmrvqrngimvqkdeqldvliklaegqgrpllns
Timeline for d1xxvb1: