SCOPe 2.04: Domain d1xwgb1: 1xwg B:81-222

Lineage for d1xwgb1 (1xwg B:81-222)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein automated matches [226848] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224956] (35 PDB entries)

8. Domain d1xwgb1: 1xwg B:81-222 [122402]
   Other proteins in same PDB: d1xwga2, d1xwgb2
   automated match to d1k3ya1
   mutant

Details for d1xwgb1

PDB Entry: 1xwg, 1.85 Å

PDB Description: human gst a1-1 t68e mutant

PDB Compounds: (B:) glutathione s-transferase a1

SCOPe Domain Sequences for d1xwgb1:

Sequence; same for both SEQRES and ATOM records:

>d1xwgb1 a.45.1.1 (B:81-222) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmdeksleearkifrf

Timeline for d1xwgb1:

• d1xwgb1 first appeared in SCOP 1.73
  
• d1xwgb1 appears in SCOPe 2.03
  
• d1xwgb1 appears in SCOPe 2.05
  
• d1xwgb1 appears in the current release, SCOPe 2.08