SCOPe 2.08: Domain d1xwga2: 1xwg A:2-80

Lineage for d1xwga2 (1xwg A:2-80)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188013] (113 PDB entries)

8. Domain d1xwga2: 1xwg A:2-80 [122401]
   Other proteins in same PDB: d1xwga1, d1xwgb1
   automated match to d1gsea2
   mutant

Details for d1xwga2

PDB Entry: 1xwg, 1.85 Å

PDB Description: human gst a1-1 t68e mutant

PDB Compounds: (A:) glutathione s-transferase a1

SCOPe Domain Sequences for d1xwga2:

Sequence; same for both SEQRES and ATOM records:

>d1xwga2 c.47.1.0 (A:2-80) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
gmklvqerailnyiaskyn

Timeline for d1xwga2:

• d1xwga2 first appeared in SCOP 1.73
  
• d1xwga2 appears in SCOPe 2.07