Lineage for d1xvoa1 (1xvo A:16-239)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 670182Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 670183Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 670328Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)
  6. 671094Protein Trypsin(ogen) [50515] (9 species)
  7. 671381Species Mold (Fusarium oxysporum) [TaxId:5507] [50521] (16 PDB entries)
  8. 671387Domain d1xvoa1: 1xvo A:16-239 [122383]
    automatically matched to d1fn8a_
    complexed with so4

Details for d1xvoa1

PDB Entry: 1xvo (more details), 0.84 Å

PDB Description: Trypsin from Fusarium oxysporum at pH 6
PDB Compounds: (A:) Trypsin

SCOP Domain Sequences for d1xvoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xvoa1 b.47.1.2 (A:16-239) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]}
ivggtsasagdfpfivsisrnggpwcggsllnantvltaahcvsgyaqsgfqiragslsr
tsggitsslssvrvhpsysgnnndlailklstsipsggnigyarlaasgsdpvagssatv
agwgatseggsstpvnllkvtvpivsratcraqygtsaitnqmfcagvssggkdscqgds
ggpivdssntligavswgngcarpnysgvyasvgalrsfidtya

SCOP Domain Coordinates for d1xvoa1:

Click to download the PDB-style file with coordinates for d1xvoa1.
(The format of our PDB-style files is described here.)

Timeline for d1xvoa1: