![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) |
![]() | Protein Trypsin(ogen) [50515] (9 species) |
![]() | Species Fungus (Fusarium oxysporum) [TaxId:5507] [50521] (16 PDB entries) |
![]() | Domain d1xvma_: 1xvm A: [122382] automated match to d1fn8a_ |
PDB Entry: 1xvm (more details), 1.1 Å
SCOPe Domain Sequences for d1xvma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xvma_ b.47.1.2 (A:) Trypsin(ogen) {Fungus (Fusarium oxysporum) [TaxId: 5507]} ivggtsasagdfpfivsisrnggpwcggsllnantvltaahcvsgyaqsgfqiragslsr tsggitsslssvrvhpsysgnnndlailklstsipsggnigyarlaasgsdpvagssatv agwgatseggsstpvnllkvtvpivsratcraqygtsaitnqmfcagvssggkdscqgds ggpivdssntligavswgngcarpnysgvyasvgalrsfidtya
Timeline for d1xvma_: