Lineage for d1xvge1 (1xvg E:3-168)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637810Fold a.23: Open three-helical up-and-down bundle [47143] (6 superfamilies)
    core: 3 helices; bundle, open
  4. 637841Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) (S)
    duplication: consists of two domains of this fold
  5. 637842Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein)
  6. 637843Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)
  7. 637844Species Methylococcus capsulatus [TaxId:414] [47155] (26 PDB entries)
  8. 637853Domain d1xvge1: 1xvg E:3-168 [122378]
    Other proteins in same PDB: d1xvga1, d1xvgb1, d1xvgc1, d1xvgd1
    automatically matched to d1fyzf_
    complexed with brj, ca, fe

Details for d1xvge1

PDB Entry: 1xvg (more details), 1.96 Å

PDB Description: soluble methane monooxygenase hydroxylase: bromoethanol soaked structure
PDB Compounds: (E:) Methane monooxygenase component A gamma chain

SCOP Domain Sequences for d1xvge1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xvge1 a.23.3.1 (E:3-168) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus [TaxId: 414]}
klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee
kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi
mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqs

SCOP Domain Coordinates for d1xvge1:

Click to download the PDB-style file with coordinates for d1xvge1.
(The format of our PDB-style files is described here.)

Timeline for d1xvge1: