Lineage for d1xvgc_ (1xvg C:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 910725Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 910726Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 911704Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 911789Protein Methane monooxygenase hydrolase beta subunit [88792] (2 species)
  7. 911790Species Methylococcus capsulatus [TaxId:414] [88793] (26 PDB entries)
  8. 911795Domain d1xvgc_: 1xvg C: [122376]
    Other proteins in same PDB: d1xvga1, d1xvgb1, d1xvge_, d1xvgf_
    automated match to d1fyzc_
    complexed with brj, ca, fe

Details for d1xvgc_

PDB Entry: 1xvg (more details), 1.96 Å

PDB Description: soluble methane monooxygenase hydroxylase: bromoethanol soaked structure
PDB Compounds: (C:) Methane monooxygenase component A beta chain

SCOPe Domain Sequences for d1xvgc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xvgc_ a.25.1.2 (C:) Methane monooxygenase hydrolase beta subunit {Methylococcus capsulatus [TaxId: 414]}
smlgerrrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnad
wiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytd
rflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslaf
wgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdw
nesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyyn
clgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvd
dwiedyasridfkadrdqivkavlaglk

SCOPe Domain Coordinates for d1xvgc_:

Click to download the PDB-style file with coordinates for d1xvgc_.
(The format of our PDB-style files is described here.)

Timeline for d1xvgc_: