Lineage for d1xvgb1 (1xvg B:18-526)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 766018Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 766019Superfamily a.25.1: Ferritin-like [47240] (9 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 766648Family a.25.1.2: Ribonucleotide reductase-like [47253] (8 proteins)
  6. 766676Protein Methane monooxygenase hydrolase alpha subunit [88789] (2 species)
  7. 766677Species Methylococcus capsulatus [TaxId:414] [88790] (26 PDB entries)
  8. 766687Domain d1xvgb1: 1xvg B:18-526 [122375]
    Other proteins in same PDB: d1xvgc1, d1xvgd1, d1xvge1, d1xvgf1
    automatically matched to d1fzia_
    complexed with brj, ca, fe

Details for d1xvgb1

PDB Entry: 1xvg (more details), 1.96 Å

PDB Description: soluble methane monooxygenase hydroxylase: bromoethanol soaked structure
PDB Compounds: (B:) Methane monooxygenase component A alpha chain

SCOP Domain Sequences for d1xvgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xvgb1 a.25.1.2 (B:18-526) Methane monooxygenase hydrolase alpha subunit {Methylococcus capsulatus [TaxId: 414]}
raptsvnaqevhrwlqsfnwdfknnrtkyatkykmanetkeqfkliakeyarmeavkder
qfgslqdaltrlnagvrvhpkwnetmkvvsnflevgeynaiaatgmlwdsaqaaeqkngy
laqvldeirhthqcayvnyyfakngqdpaghndarrtrtigplwkgmkrvfsdgfisgda
vecslnlqlvgeacftnplivavtewaaangdeitptvflsietdelrhmangyqtvvsi
andpasakylntdlnnafwtqqkyftpvlgmlfeygskfkvepwvktwdrwvyedwggiw
igrlgkygvesprslkdakqdaywahhdlyllayalwptgffrlalpdqeemewfeanyp
gwydhygkiyeewrargcedpssgfiplmwfiennhpiyidrvsqvpfcpslakgastlr
vheyngemhtfsdqwgermwlaeperyecqnifeqyegrelseviaelhglrsdgktlia
qphvrgdklwtlddikrlncvfknpvkaf

SCOP Domain Coordinates for d1xvgb1:

Click to download the PDB-style file with coordinates for d1xvgb1.
(The format of our PDB-style files is described here.)

Timeline for d1xvgb1: