Lineage for d1xvfe_ (1xvf E:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 909741Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
    core: 3 helices; bundle, open
  4. 909772Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) (S)
    duplication: consists of two domains of this fold
  5. 909773Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein)
  6. 909774Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)
  7. 909775Species Methylococcus capsulatus [TaxId:414] [47155] (26 PDB entries)
  8. 909788Domain d1xvfe_: 1xvf E: [122372]
    Other proteins in same PDB: d1xvfa1, d1xvfb1, d1xvfc_, d1xvfd_
    automated match to d1fyzf_
    complexed with 3cl, fe

Details for d1xvfe_

PDB Entry: 1xvf (more details), 2 Å

PDB Description: soluble methane monooxygenase hydroxylase: chloropropanol soaked structure
PDB Compounds: (E:) Methane monooxygenase component A gamma chain

SCOPe Domain Sequences for d1xvfe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xvfe_ a.23.3.1 (E:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus [TaxId: 414]}
klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee
kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi
mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqs

SCOPe Domain Coordinates for d1xvfe_:

Click to download the PDB-style file with coordinates for d1xvfe_.
(The format of our PDB-style files is described here.)

Timeline for d1xvfe_: