SCOP 1.73: Domain d1xvfc1: 1xvf C:2-389

Lineage for d1xvfc1 (1xvf C:2-389)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.25: Ferritin-like [47239] (4 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (5 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (8 proteins)

6. Protein Methane monooxygenase hydrolase beta subunit [88792] (2 species)

7. Species Methylococcus capsulatus [TaxId:414] [88793] (23 PDB entries)

8. Domain d1xvfc1: 1xvf C:2-389 [122370]
   Other proteins in same PDB: d1xvfa1, d1xvfb1, d1xvfe1, d1xvff1
   automatically matched to d1fyzc_
   complexed with 3cl, fe

Details for d1xvfc1

PDB Entry: 1xvf, 2 Å

PDB Description: soluble methane monooxygenase hydroxylase: chloropropanol soaked structure

PDB Compounds: (C:) Methane monooxygenase component A beta chain

SCOP Domain Sequences for d1xvfc1:

Sequence; same for both SEQRES and ATOM records:

>d1xvfc1 a.25.1.2 (C:2-389) Methane monooxygenase hydrolase beta subunit {Methylococcus capsulatus [TaxId: 414]}
smlgerrrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnad
wiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytd
rflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslaf
wgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdw
nesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyyn
clgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvd
dwiedyasridfkadrdqivkavlaglk

Timeline for d1xvfc1:

• d1xvfc1 is new in SCOP 1.73
  
• d1xvfc1 appears in SCOP 1.75
  
• d1xvfc1 appears in the current release, SCOPe 2.08, called d1xvfc_