Lineage for d1xvef1 (1xve F:4-168)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 765254Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
    core: 3 helices; bundle, open
  4. 765285Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) (S)
    duplication: consists of two domains of this fold
  5. 765286Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein)
  6. 765287Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)
  7. 765288Species Methylococcus capsulatus [TaxId:414] [47155] (26 PDB entries)
  8. 765332Domain d1xvef1: 1xve F:4-168 [122367]
    Other proteins in same PDB: d1xvea1, d1xveb1, d1xvec1, d1xved1
    automatically matched to d1fyzf_
    complexed with 3bb, ca, fe

Details for d1xvef1

PDB Entry: 1xve (more details), 2.4 Å

PDB Description: soluble methane monooxygenase hydroxylase: 3-bromo-3-butenol soaked structure
PDB Compounds: (F:) Methane monooxygenase component A gamma chain

SCOP Domain Sequences for d1xvef1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xvef1 a.23.3.1 (F:4-168) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus [TaxId: 414]}
lgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieakleek
vavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppim
pvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqs

SCOP Domain Coordinates for d1xvef1:

Click to download the PDB-style file with coordinates for d1xvef1.
(The format of our PDB-style files is described here.)

Timeline for d1xvef1: