Lineage for d1xvdf1 (1xvd F:4-168)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637810Fold a.23: Open three-helical up-and-down bundle [47143] (6 superfamilies)
    core: 3 helices; bundle, open
  4. 637841Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) (S)
    duplication: consists of two domains of this fold
  5. 637842Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein)
  6. 637843Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)
  7. 637844Species Methylococcus capsulatus [TaxId:414] [47155] (26 PDB entries)
  8. 637880Domain d1xvdf1: 1xvd F:4-168 [122361]
    Other proteins in same PDB: d1xvda1, d1xvdb1, d1xvdc1, d1xvdd1
    automatically matched to d1fyzf_
    complexed with fe, fpn

Details for d1xvdf1

PDB Entry: 1xvd (more details), 2.3 Å

PDB Description: Soluble methane monooxygenase hydroxylase: 4-fluorophenol soaked structure
PDB Compounds: (F:) Methane monooxygenase component A gamma chain

SCOP Domain Sequences for d1xvdf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xvdf1 a.23.3.1 (F:4-168) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus [TaxId: 414]}
lgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieakleek
vavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppim
pvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqs

SCOP Domain Coordinates for d1xvdf1:

Click to download the PDB-style file with coordinates for d1xvdf1.
(The format of our PDB-style files is described here.)

Timeline for d1xvdf1: