Class a: All alpha proteins [46456] (258 folds) |
Fold a.23: Open three-helical up-and-down bundle [47143] (6 superfamilies) core: 3 helices; bundle, open |
Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) duplication: consists of two domains of this fold |
Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein) |
Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species) |
Species Methylococcus capsulatus [TaxId:414] [47155] (26 PDB entries) |
Domain d1xvce1: 1xvc E:3-168 [122354] Other proteins in same PDB: d1xvca1, d1xvcb1, d1xvcc1, d1xvcd1 automatically matched to d1fyzf_ complexed with 5br, bmm, br, fe, fmt |
PDB Entry: 1xvc (more details), 2 Å
SCOP Domain Sequences for d1xvce1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xvce1 a.23.3.1 (E:3-168) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus [TaxId: 414]} klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqs
Timeline for d1xvce1: