Lineage for d1xvcc1 (1xvc C:2-389)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 766018Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 766019Superfamily a.25.1: Ferritin-like [47240] (9 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 766648Family a.25.1.2: Ribonucleotide reductase-like [47253] (8 proteins)
  6. 766739Protein Methane monooxygenase hydrolase beta subunit [88792] (2 species)
  7. 766740Species Methylococcus capsulatus [TaxId:414] [88793] (23 PDB entries)
  8. 766761Domain d1xvcc1: 1xvc C:2-389 [122352]
    Other proteins in same PDB: d1xvca1, d1xvcb1, d1xvce1, d1xvcf1
    automatically matched to d1fyzc_
    complexed with 5br, bmm, br, fe, fmt

Details for d1xvcc1

PDB Entry: 1xvc (more details), 2 Å

PDB Description: soluble methane monooxygenase hydroxylase: 8-bromooctanol soaked structure
PDB Compounds: (C:) Methane monooxygenase component A beta chain

SCOP Domain Sequences for d1xvcc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xvcc1 a.25.1.2 (C:2-389) Methane monooxygenase hydrolase beta subunit {Methylococcus capsulatus [TaxId: 414]}
smlgerrrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnad
wiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytd
rflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslaf
wgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdw
nesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyyn
clgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvd
dwiedyasridfkadrdqivkavlaglk

SCOP Domain Coordinates for d1xvcc1:

Click to download the PDB-style file with coordinates for d1xvcc1.
(The format of our PDB-style files is described here.)

Timeline for d1xvcc1: