Lineage for d1xvcb1 (1xvc B:18-526)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1084172Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1084173Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1085170Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 1085198Protein Methane monooxygenase hydrolase alpha subunit [88789] (2 species)
  7. 1085199Species Methylococcus capsulatus [TaxId:414] [88790] (26 PDB entries)
  8. 1085217Domain d1xvcb1: 1xvc B:18-526 [122351]
    Other proteins in same PDB: d1xvcc_, d1xvcd_, d1xvce_, d1xvcf_
    automatically matched to d1fzia_
    complexed with 5br, bmm, br, fe, fmt

Details for d1xvcb1

PDB Entry: 1xvc (more details), 2 Å

PDB Description: soluble methane monooxygenase hydroxylase: 8-bromooctanol soaked structure
PDB Compounds: (B:) Methane monooxygenase component A alpha chain

SCOPe Domain Sequences for d1xvcb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xvcb1 a.25.1.2 (B:18-526) Methane monooxygenase hydrolase alpha subunit {Methylococcus capsulatus [TaxId: 414]}
raptsvnaqevhrwlqsfnwdfknnrtkyatkykmanetkeqfkliakeyarmeavkder
qfgslqdaltrlnagvrvhpkwnetmkvvsnflevgeynaiaatgmlwdsaqaaeqkngy
laqvldeirhthqcayvnyyfakngqdpaghndarrtrtigplwkgmkrvfsdgfisgda
vecslnlqlvgeacftnplivavtewaaangdeitptvflsietdelrhmangyqtvvsi
andpasakylntdlnnafwtqqkyftpvlgmlfeygskfkvepwvktwdrwvyedwggiw
igrlgkygvesprslkdakqdaywahhdlyllayalwptgffrlalpdqeemewfeanyp
gwydhygkiyeewrargcedpssgfiplmwfiennhpiyidrvsqvpfcpslakgastlr
vheyngemhtfsdqwgermwlaeperyecqnifeqyegrelseviaelhglrsdgktlia
qphvrgdklwtlddikrlncvfknpvkaf

SCOPe Domain Coordinates for d1xvcb1:

Click to download the PDB-style file with coordinates for d1xvcb1.
(The format of our PDB-style files is described here.)

Timeline for d1xvcb1: