SCOPe 2.01: Domain d1xu5f_: 1xu5 F:

Lineage for d1xu5f_ (1xu5 F:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
   core: 3 helices; bundle, open

4. Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family)
   duplication: consists of two domains of this fold

5. Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein)

6. Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)

7. Species Methylococcus capsulatus [TaxId:414] [47155] (26 PDB entries)

8. Domain d1xu5f_: 1xu5 F: [122331]
   Other proteins in same PDB: d1xu5a1, d1xu5b1, d1xu5c_, d1xu5d_
   automated match to d1fyzf_
   complexed with fe, iph, oh

Details for d1xu5f_

PDB Entry: 1xu5, 1.96 Å

PDB Description: Soluble methane monooxygenase hydroxylase-phenol soaked

PDB Compounds: (F:) Methane monooxygenase component A gamma chain

SCOPe Domain Sequences for d1xu5f_:

Sequence; same for both SEQRES and ATOM records:

>d1xu5f_ a.23.3.1 (F:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus [TaxId: 414]}
lgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieakleek
vavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppim
pvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqsp

Timeline for d1xu5f_:

• d1xu5f_ first appeared in SCOP 1.73, called d1xu5f1
  
• d1xu5f_ was called d1xu5f1 in SCOP 1.75
  
• d1xu5f_ appears in SCOPe 2.02
  
• d1xu5f_ appears in the current release, SCOPe 2.08