Lineage for d1xu5e1 (1xu5 E:3-168)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 765254Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
    core: 3 helices; bundle, open
  4. 765285Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) (S)
    duplication: consists of two domains of this fold
  5. 765286Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein)
  6. 765287Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)
  7. 765288Species Methylococcus capsulatus [TaxId:414] [47155] (26 PDB entries)
  8. 765295Domain d1xu5e1: 1xu5 E:3-168 [122330]
    Other proteins in same PDB: d1xu5a1, d1xu5b1, d1xu5c1, d1xu5d1
    automatically matched to d1fyzf_
    complexed with fe, iph, oh

Details for d1xu5e1

PDB Entry: 1xu5 (more details), 1.96 Å

PDB Description: Soluble methane monooxygenase hydroxylase-phenol soaked
PDB Compounds: (E:) Methane monooxygenase component A gamma chain

SCOP Domain Sequences for d1xu5e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xu5e1 a.23.3.1 (E:3-168) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus [TaxId: 414]}
klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee
kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi
mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqs

SCOP Domain Coordinates for d1xu5e1:

Click to download the PDB-style file with coordinates for d1xu5e1.
(The format of our PDB-style files is described here.)

Timeline for d1xu5e1: