Lineage for d1xu5a1 (1xu5 A:18-526)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 766018Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 766019Superfamily a.25.1: Ferritin-like [47240] (9 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 766648Family a.25.1.2: Ribonucleotide reductase-like [47253] (8 proteins)
  6. 766676Protein Methane monooxygenase hydrolase alpha subunit [88789] (2 species)
  7. 766677Species Methylococcus capsulatus [TaxId:414] [88790] (26 PDB entries)
  8. 766684Domain d1xu5a1: 1xu5 A:18-526 [122326]
    Other proteins in same PDB: d1xu5c1, d1xu5d1, d1xu5e1, d1xu5f1
    automatically matched to d1fzia_
    complexed with fe, iph, oh

Details for d1xu5a1

PDB Entry: 1xu5 (more details), 1.96 Å

PDB Description: Soluble methane monooxygenase hydroxylase-phenol soaked
PDB Compounds: (A:) Methane monooxygenase component A alpha chain

SCOP Domain Sequences for d1xu5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xu5a1 a.25.1.2 (A:18-526) Methane monooxygenase hydrolase alpha subunit {Methylococcus capsulatus [TaxId: 414]}
raptsvnaqevhrwlqsfnwdfknnrtkyatkykmanetkeqfkliakeyarmeavkder
qfgslqdaltrlnagvrvhpkwnetmkvvsnflevgeynaiaatgmlwdsaqaaeqkngy
laqvldeirhthqcayvnyyfakngqdpaghndarrtrtigplwkgmkrvfsdgfisgda
vecslnlqlvgeacftnplivavtewaaangdeitptvflsietdelrhmangyqtvvsi
andpasakylntdlnnafwtqqkyftpvlgmlfeygskfkvepwvktwdrwvyedwggiw
igrlgkygvesprslkdakqdaywahhdlyllayalwptgffrlalpdqeemewfeanyp
gwydhygkiyeewrargcedpssgfiplmwfiennhpiyidrvsqvpfcpslakgastlr
vheyngemhtfsdqwgermwlaeperyecqnifeqyegrelseviaelhglrsdgktlia
qphvrgdklwtlddikrlncvfknpvkaf

SCOP Domain Coordinates for d1xu5a1:

Click to download the PDB-style file with coordinates for d1xu5a1.
(The format of our PDB-style files is described here.)

Timeline for d1xu5a1: