Lineage for d1xu3d1 (1xu3 D:2-389)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 766018Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 766019Superfamily a.25.1: Ferritin-like [47240] (9 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 766648Family a.25.1.2: Ribonucleotide reductase-like [47253] (8 proteins)
  6. 766739Protein Methane monooxygenase hydrolase beta subunit [88792] (2 species)
  7. 766740Species Methylococcus capsulatus [TaxId:414] [88793] (23 PDB entries)
  8. 766772Domain d1xu3d1: 1xu3 D:2-389 [122323]
    Other proteins in same PDB: d1xu3a1, d1xu3b1, d1xu3e1, d1xu3f1
    automatically matched to d1fyzc_
    complexed with bml, fe

Details for d1xu3d1

PDB Entry: 1xu3 (more details), 2.3 Å

PDB Description: Soluble methane monooxygenase hydroxylase-soaked with bromophenol
PDB Compounds: (D:) Methane monooxygenase component A beta chain

SCOP Domain Sequences for d1xu3d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xu3d1 a.25.1.2 (D:2-389) Methane monooxygenase hydrolase beta subunit {Methylococcus capsulatus [TaxId: 414]}
smlgerrrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnad
wiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytd
rflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslaf
wgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdw
nesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyyn
clgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvd
dwiedyasridfkadrdqivkavlaglk

SCOP Domain Coordinates for d1xu3d1:

Click to download the PDB-style file with coordinates for d1xu3d1.
(The format of our PDB-style files is described here.)

Timeline for d1xu3d1: