Class a: All alpha proteins [46456] (285 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) contains one classic and one pseudo HhH motifs |
Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins) topological similarity to the N-terminal domain automatically mapped to Pfam PF10391 |
Protein DNA polymerase lambda [101253] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101254] (25 PDB entries) |
Domain d1xsle2: 1xsl E:329-385 [122274] Other proteins in same PDB: d1xsla1, d1xsla3, d1xsle1, d1xsle3, d1xsli1, d1xsli3, d1xslm1, d1xslm3 automatically matched to d1rzta2 protein/DNA complex; complexed with cac, mg, na |
PDB Entry: 1xsl (more details), 2.3 Å
SCOPe Domain Sequences for d1xsle2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xsle2 a.60.12.1 (E:329-385) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]} sesvpvlelfsniwgagtktaqmwyqqgfrsledirsqaslttqqaiglkhysdfle
Timeline for d1xsle2: