Lineage for d1xrub1 (1xru B:1-277)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 809734Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 809735Superfamily b.82.1: RmlC-like cupins [51182] (24 families) (S)
  5. 810060Family b.82.1.13: KduI-like [110318] (1 protein)
    Pfam PF04962: duplication: consists of two germin-like domains
  6. 810061Protein 5-keto-4-deoxyuronate isomerase KduI [110319] (2 species)
  7. 810069Species Escherichia coli [TaxId:562] [110320] (2 PDB entries)
    Uniprot Q46938 1-266
  8. 810071Domain d1xrub1: 1xru B:1-277 [122263]
    automatically matched to 1XRU A:1-277
    complexed with 1pe, zn

Details for d1xrub1

PDB Entry: 1xru (more details), 1.94 Å

PDB Description: Crystal Structure of 5-keto-4-deoxyuronate Isomerase from Eschericia coli
PDB Compounds: (B:) 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase

SCOP Domain Sequences for d1xrub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xrub1 b.82.1.13 (B:1-277) 5-keto-4-deoxyuronate isomerase KduI {Escherichia coli [TaxId: 562]}
mdvrqsihsahaktldtqglrneflvekvfvadeytmvyshidriivggimpitktvsvg
gevgkqlgvsyflerrelgviniggagtitvdgqcyeighrdalyvgkgakevvfasidt
gtpakfyyncapahttyptkkvtpdevspvtlgdnltsnrrtinkyfvpdvletcqlsmg
ltelapgnlwntmpchtherrmevyfyfnmdddacvfhmmgqpqetrhivmhneqavisp
swsihsgvgtkaytfiwgmvgenqvfddmdhvavkei

SCOP Domain Coordinates for d1xrub1:

Click to download the PDB-style file with coordinates for d1xrub1.
(The format of our PDB-style files is described here.)

Timeline for d1xrub1: