SCOPe 2.08: Domain d1xrua1: 1xru A:1-277

Lineage for d1xrua1 (1xru A:1-277)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.13: KduI-like [110318] (1 protein)
   Pfam PF04962: duplication: consists of two germin-like domains

6. Protein 5-keto-4-deoxyuronate isomerase KduI [110319] (2 species)

7. Species Escherichia coli [TaxId:562] [110320] (2 PDB entries)
   Uniprot Q46938 1-266

8. Domain d1xrua1: 1xru A:1-277 [122262]
   Other proteins in same PDB: d1xrua2, d1xrub3
   complexed with 1pe, zn

Details for d1xrua1

PDB Entry: 1xru, 1.94 Å

PDB Description: Crystal Structure of 5-keto-4-deoxyuronate Isomerase from Eschericia coli

PDB Compounds: (A:) 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase

SCOPe Domain Sequences for d1xrua1:

Sequence; same for both SEQRES and ATOM records:

>d1xrua1 b.82.1.13 (A:1-277) 5-keto-4-deoxyuronate isomerase KduI {Escherichia coli [TaxId: 562]}
mdvrqsihsahaktldtqglrneflvekvfvadeytmvyshidriivggimpitktvsvg
gevgkqlgvsyflerrelgviniggagtitvdgqcyeighrdalyvgkgakevvfasidt
gtpakfyyncapahttyptkkvtpdevspvtlgdnltsnrrtinkyfvpdvletcqlsmg
ltelapgnlwntmpchtherrmevyfyfnmdddacvfhmmgqpqetrhivmhneqavisp
swsihsgvgtkaytfiwgmvgenqvfddmdhvavkei

Timeline for d1xrua1:

• d1xrua1 first appeared in SCOP 1.73
  
• d1xrua1 appears in SCOPe 2.07