Lineage for d1xr9a1 (1xr9 A:182-276)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 932656Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 932657Species Human (Homo sapiens) [TaxId:9606] [88605] (157 PDB entries)
    Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor
  8. 932699Domain d1xr9a1: 1xr9 A:182-276 [122250]
    Other proteins in same PDB: d1xr9a2, d1xr9b_
    automatically matched to d1a1ma1
    complexed with gol, so4, ure

Details for d1xr9a1

PDB Entry: 1xr9 (more details), 1.79 Å

PDB Description: Crystal Structures of HLA-B*1501 in Complex with Peptides from Human UbcH6 and Epstein-Barr Virus EBNA-3
PDB Compounds: (A:) HLA class I histocompatibility antigen, B-15 alpha chain

SCOPe Domain Sequences for d1xr9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xr9a1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
adppkthvthhpisdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf
qkwaavvvpsgeeqrytchvqheglpkpltlrwep

SCOPe Domain Coordinates for d1xr9a1:

Click to download the PDB-style file with coordinates for d1xr9a1.
(The format of our PDB-style files is described here.)

Timeline for d1xr9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xr9a2
View in 3D
Domains from other chains:
(mouse over for more information)
d1xr9b_