Lineage for d1xqcc1 (1xqc C:307-548)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 776482Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 776483Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 776484Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (33 proteins)
  6. 776557Protein Estrogen receptor alpha [48519] (1 species)
  7. 776558Species Human (Homo sapiens) [TaxId:9606] [48520] (29 PDB entries)
    Uniprot P03372 307-551
  8. 776583Domain d1xqcc1: 1xqc C:307-548 [122235]
    automatically matched to d1qkta_
    complexed with aej; mutant

Details for d1xqcc1

PDB Entry: 1xqc (more details), 2.05 Å

PDB Description: X-ray structure of ERalpha LBD bound to a tetrahydroisoquinoline SERM ligand at 2.05A resolution
PDB Compounds: (C:) Estrogen receptor

SCOP Domain Sequences for d1xqcc1:

Sequence, based on SEQRES records: (download)

>d1xqcc1 a.123.1.1 (C:307-548) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
alsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvpg
fvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifd
mllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtl
ihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvplydlllemlda
hr

Sequence, based on observed residues (ATOM records): (download)

>d1xqcc1 a.123.1.1 (C:307-548) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
alsltadqmvsalldaeppilysesmmglltnladrelvhminwakrvpgfvdltlhdqv
hllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifdmllatssrfr
mmnlqgeefvclksiillnsgvytfstlksleekdhihrvldkitdtlihlmakagltlq
qqhqrlaqlllilshirhmsnkgmehlysmplydlllemldahr

SCOP Domain Coordinates for d1xqcc1:

Click to download the PDB-style file with coordinates for d1xqcc1.
(The format of our PDB-style files is described here.)

Timeline for d1xqcc1: